General Information

  • ID:  hor001986
  • Uniprot ID:  P13589
  • Protein name:  Pituitary adenylate cyclase-activating polypeptide 38
  • Gene name:  ADCYAP1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0016521 pituitary adenylate cyclase activating polypeptide activity; GO:0031858 pituitary adenylate cyclase-activating polypeptide receptor binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001541 ovarian follicle development; GO:0001662 behavioral fear response; GO:0001821 histamine secretion; GO:0001932 regulation of protein phosphorylation; GO:0002865 negative regulation of acute inflammatory response to antigenic stimulus; GO:0002878 negative regulation of acute inflammatory response to non-antigenic stimulus; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0007399 nervous system development; GO:0008277 regulation of G protein-coupled receptor signaling pathway; GO:0008284 positive regulation of cell population proliferation; GO:0010628 positive regulation of gene expression; GO:0010656 negative regulation of muscle cell apoptotic process; GO:0010976 positive regulation of neuron projection development; GO:0019933 cAMP-mediated signaling; GO:0021983 pituitary gland development; GO:0030073 insulin secretion; GO:0031175 neuron projection development; GO:0032755 positive regulation of interleukin-6 production; GO:0032879 regulation of localization; GO:0032880 regulation of protein localization; GO:0042311 vasodilation; GO:0042594 response to starvation; GO:0043267 negative regulation of potassium ion transport; GO:0043547 positive regulation of GTPase activity; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0045471 response to ethanol; GO:0045786 negative regulation of cell cycle; GO:0045860 positive regulation of protein kinase activity; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0051968 positive regulation of synaptic transmission, glutamatergic; GO:0060078 regulation of postsynaptic membrane potential; GO:0060124 positive regulation of growth hormone secretion; GO:0060253 negative regulation of glial cell proliferation; GO:0070374 positive re
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005829 cytosol; GO:0043005 neuron projection; GO:0043195 terminal bouton; GO:0043204 perikaryon

Sequence Information

  • Sequence:  HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
  • Length:  38
  • Propeptide:  MTMCSGARLALLVYGIIMHNSVSCSPAAGLSFPGIRPEEEAYDQDGNPLQDFYDWDPPGAGSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYLQSMVARGMGENLAAAAVDDRAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
  • Signal peptide:  MTMCSGARLALLVYGIIMHNSVSC
  • Modification:  T27 Leucine amide;T38 Lysine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cells. Promotes neuron projection development through the RAPGEF2/Rap3/B-Raf/ERK pathway. In chromaffin cells, induces long-lasting increase of intracellular calcium concentrations and neuroendocrine secretion. Involved in the control of glucose homeostasis, induces insulin secretion by pancreatic beta cells.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  Adcyap1r1
  • Target Unid:  P32215
  • IC50: IC50 = 7.7±1.4 nM ( PubMed ID: 18353507 )
  • EC50: 6.5±0.8nM
  • ED50: NA
  • kd: NA
  • Half life: 23±6 minutes; /1380 seconds ( PubMed ID: 18353507 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P13589-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001986_AF2.pdbhor001986_ESM.pdb

Physical Information

Mass: 519543 Formula: C203H330N62O54S
Absent amino acids: CEPW Common amino acids: K
pI: 11.01 Basic residues: 12
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: -106.05 Boman Index: -11216
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 61.58
Instability Index: 3599.21 Extinction Coefficient cystines: 5960
Absorbance 280nm: 161.08

Literature

  • PubMed ID:  2803320##18353507
  • Title:  Isolation of a Novel 38 Residue-Hypothalamic Polypeptide Which Stimulates Adenylate Cyclase in Pituitary Cells